Quick start¶
A complete first simulation in 20 lines: bind to a bundled cartridge, append a recombination pass with the productive constraint, run 1,000 seeded records, and inspect the output.
Your learning path
You're at step 2 of the "I want to simulate sequences" path. Next: Your first AIRR record explains the fields in the output; then The Experiment builder covers the full DSL surface. See all paths →
The whole thing¶
import GenAIRR as ga
result = (
ga.Experiment.on("human_igh") # bind to bundled human IGH cartridge
.recombine() # append V(D)J recombination pass
.productive_only() # constraint-aware: only productive sequences
.run_records(n=1000, seed=42) # compile + run + project to AIRR records
)
print(len(result)) # 1000
rec = result[0]
print(rec["v_call"],
rec["d_call"],
rec["j_call"]) # 'IGHVF10-G38*04 IGHD2-15*01 IGHJ2*01'
print(rec["junction_aa"]) # 'CVKDDGNRGYCSGGSCYGRCCALDYWYFDLW'
print(rec["productive"]) # True
If this runs and prints, you're done with the first simulation.
The mental model¶
Three nouns carry GenAIRR's surface. Once you have these mapped, the rest of the API follows from them.
| Noun | Role | Example |
|---|---|---|
Experiment |
The pipeline. A fluent builder of biology + library + sequencing passes. | ga.Experiment.on("human_igh").recombine().mutate(rate=0.05) |
DataConfig |
The reference cartridge. Identity, allele catalogue, rules, empirical models - everything the engine needs to know about the biology it's simulating. | ga.HUMAN_IGH_OGRDB, or load via the string shortcut "human_igh" |
SimulationResult |
The output. A list-like wrapper around a batch of AIRR record dicts plus the underlying Outcome objects for advanced introspection. |
result = exp.run_records(n=100); result[0]["v_call"] |
Every method call on Experiment returns the same Experiment,
extended with one more step. The pipeline only actually runs when
you call .run_records(...) (or .compile().run(...) if you want
the compiled plan first). This means the DSL composes cleanly:
recombine().mutate().pcr_amplify() builds the plan, then
run_records(n=..., seed=...) executes it.
What each step does¶
| Step | Effect |
|---|---|
Experiment.on("human_igh") |
Bind to the bundled human IGH cartridge. Other shortcuts: "human_igk", "human_igl", "mouse_igh", "human_tcrb". Pass a DataConfig instead of a string for a custom cartridge. (Only human IGH/IGK/IGL/TCRB carry real data-derived distributions — other species use uniform placeholders.) |
.recombine() |
Append a V(D)J recombination pass - sample alleles, trim, fill NP1/NP2, assemble. Defaults to the cartridge's empirical models. |
.productive_only() |
Constraint-aware: the engine samples only choices that produce a productive sequence (in-frame junction, no stop codons, anchors preserved). No retry loops. |
.run_records(n=1000, seed=42) |
Compile the plan, run 1,000 seeded draws, project each into an AIRR-format record. Same seed → byte-identical output across runs and platforms. |
What you can do next¶
The simulation's done; now you can:
- Inspect your first AIRR record - what each field means and where it came from.
- Export the results - AIRR TSV, FASTA, FASTQ, paired-end FASTQ, pandas DataFrame.
- Validate the output - run the postcondition validator to confirm every field is internally consistent.
- Build your own cartridge the four-plane cartridge model and how to author a custom reference from FASTA.
Next step¶
→ Your first AIRR record - read the output field by field.