Skip to content

Quick start

A complete first simulation in 20 lines: bind to a bundled cartridge, append a recombination pass with the productive constraint, run 1,000 seeded records, and inspect the output.

Your learning path

You're at step 2 of the "I want to simulate sequences" path. Next: Your first AIRR record explains the fields in the output; then The Experiment builder covers the full DSL surface. See all paths →

The whole thing

import GenAIRR as ga

result = (
    ga.Experiment.on("human_igh")     # bind to bundled human IGH cartridge
      .recombine()                    # append V(D)J recombination pass
      .productive_only()              # constraint-aware: only productive sequences
      .run_records(n=1000, seed=42)   # compile + run + project to AIRR records
)

print(len(result))               # 1000
rec = result[0]
print(rec["v_call"],
      rec["d_call"],
      rec["j_call"])              # 'IGHVF10-G38*04 IGHD2-15*01 IGHJ2*01'
print(rec["junction_aa"])         # 'CVKDDGNRGYCSGGSCYGRCCALDYWYFDLW'
print(rec["productive"])          # True

If this runs and prints, you're done with the first simulation.

The mental model

Three nouns carry GenAIRR's surface. Once you have these mapped, the rest of the API follows from them.

Noun Role Example
Experiment The pipeline. A fluent builder of biology + library + sequencing passes. ga.Experiment.on("human_igh").recombine().mutate(rate=0.05)
DataConfig The reference cartridge. Identity, allele catalogue, rules, empirical models - everything the engine needs to know about the biology it's simulating. ga.HUMAN_IGH_OGRDB, or load via the string shortcut "human_igh"
SimulationResult The output. A list-like wrapper around a batch of AIRR record dicts plus the underlying Outcome objects for advanced introspection. result = exp.run_records(n=100); result[0]["v_call"]

Every method call on Experiment returns the same Experiment, extended with one more step. The pipeline only actually runs when you call .run_records(...) (or .compile().run(...) if you want the compiled plan first). This means the DSL composes cleanly: recombine().mutate().pcr_amplify() builds the plan, then run_records(n=..., seed=...) executes it.

What each step does

Step Effect
Experiment.on("human_igh") Bind to the bundled human IGH cartridge. Other shortcuts: "human_igk", "human_igl", "mouse_igh", "human_tcrb". Pass a DataConfig instead of a string for a custom cartridge. (Only human IGH/IGK/IGL/TCRB carry real data-derived distributions — other species use uniform placeholders.)
.recombine() Append a V(D)J recombination pass - sample alleles, trim, fill NP1/NP2, assemble. Defaults to the cartridge's empirical models.
.productive_only() Constraint-aware: the engine samples only choices that produce a productive sequence (in-frame junction, no stop codons, anchors preserved). No retry loops.
.run_records(n=1000, seed=42) Compile the plan, run 1,000 seeded draws, project each into an AIRR-format record. Same seed → byte-identical output across runs and platforms.

What you can do next

The simulation's done; now you can:


Next step

Your first AIRR record - read the output field by field.